15% OFF $150+· CodeFALL15
Ends October 15Shop now
Lot certificates published
Plain, secure packaging

parent and analog

Semax vs N-Acetyl Semax Amidate

These records share the seven-residue Semax sequence. The amidate record specifies additional N-terminal acetyl and C-terminal amide groups.

Published: 2026-10-03Library record comparison: 2026-10-03

01

Identity side by side

Recorded molecular identities of Semax and N-Acetyl Semax Amidate
Recorded fieldSemaxN-Acetyl Semax Amidate
Canonical nameSemaxN-Acetyl Semax Amidate
AliasesACTH(4-7)-Pro-Gly-Pronot recorded
Development codesnot recordednot recorded
CAS80714-61-0not recorded
UNIII5FAL2585Hnot recorded
PubChem CID9811102172638603
Molecular formulaC37H51N9O10SC39H54N10O10S
Molecular weight (Da)813.9855
Sequence length (residues)77
Terminal modificationsnot recordedN-terminal acetylation at Met1; C-terminal amide at Pro7
Structural modificationsnot recordednot recorded

Semax: nomenclature notes

The PubChem record describes Semax as ACTH(4-7) extended with Pro-Gly-Pro. The catalog separately lists N-acetyl semax amidate, which carries an N-terminal acetyl group and a C-terminal amide; that is a distinct molecule with a different formula, mass, and registry number, and it is not covered by this record. Much of the published literature instead describes Semax as an ACTH(4-10) analogue. Both descriptions refer to the same molecule: Semax retains ACTH residues 4 to 7 (Met-Glu-His-Phe) and substitutes Pro-Gly-Pro for residues 8 to 10 (Arg-Trp-Gly). This record uses the ACTH(4-7)-plus-Pro-Gly-Pro form because it states the composition of the molecule rather than the fragment it was designed from.

N-Acetyl Semax Amidate: nomenclature notes

The complete name specifies both terminal groups. A bare N-acetyl Semax label does not specify the C-terminal group and is not an alias here. Acetate salt terminology does not establish covalent N-acetylation. PubChem CID 172638603 represents the recorded amidate structure. No CAS or UNII is assigned here because no authoritative assignment was verified.

02

Residue sequence comparison

Positions are numbered from each stored sequence’s first residue. Highlighted cells differ or extend beyond the other chain; a dash indicates no aligned residue. One-letter notation does not encode terminal groups or stereochemistry. Read the recorded notes below.

Aligned one-letter residue sequences
Semax1M2E3H4F5P6G7P
N-Acetyl Semax Amidate1M2E3H4F5P6G7P

Differences in text

The stored one-letter residue sequences match at every position. Recorded terminal and structural features remain separate identity fields.

Semax

Terminal modifications
not recorded
Structural modifications
not recorded
Stored three-letter notation
Met · Glu · His · Phe · Pro · Gly · Pro
Sequence notes
Sequence Met-Glu-His-Phe-Pro-Gly-Pro. Met-Glu-His-Phe is residues 4 to 7 of human ACTH(1-39) (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF); Pro-Gly-Pro is the synthetic C-terminal extension, not an ACTH sequence. The molecular formula and average mass recorded below are the values derived from this sequence.

N-Acetyl Semax Amidate

Terminal modifications
N-terminal acetylation at Met1; C-terminal amide at Pro7
Structural modifications
not recorded
Stored three-letter notation
Ac · Met · Glu · His · Phe · Pro · Gly · Pro · NH2
Sequence notes
The seven residue positions are unchanged from Semax. Ac and NH2 denote the N-terminal acetyl and C-terminal amide groups; they are not additional residues.

03

Recorded mechanisms

These lists show the links recorded in each monograph. An unlisted link does not establish its absence from the molecule’s biology.

Shared recorded links

not recorded

Recorded only for Semax

not recorded

Recorded only for N-Acetyl Semax Amidate

not recorded

04

Recorded compound classes

Recorded only for Semax

not recorded

Recorded only for N-Acetyl Semax Amidate

not recorded

05

References for the relationship

06

Read the full monographs