Compound monograph
GIP(1-42)
GIP is a 42-residue endogenous incretin hormone and the native ligand of the GIP receptor.
01
Identity & nomenclature
GIP is a 42-residue endogenous incretin hormone and the native ligand of the GIP receptor.
'Gastric inhibitory polypeptide' is the historical name for this same hormone, not a different peptide. Species must stay explicit: human GIP differs from porcine at residues 18 and 34. Full-length GIP must not be merged with GIP(3-42), GIP(1-30)amide, or proGIP — DPP-IV cleavage changes the molecule and its pharmacology. No CAS registry number is recorded. A supplier-supported number was proposed during scoping but was never reconciled to an authoritative registry and does not resolve in PubChem. The PubChem CID recorded here was reached by name and is retained because its molecular formula matches the sequence-derived formula exactly; the name alone would not be sufficient evidence.
Declared aliases and development codes: GIP, Gastric inhibitory polypeptide, Glucose-dependent insulinotropic peptide.
02
Molecular properties
| Molecular formula | C226H338N60O66S |
|---|---|
| Molecular mass | 4983.6 Da |
| PubChem CID | 131954558 |
| UNII | 1O4H75S7H2 |
| One-letter sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Forty-two residues, free at both termini. Note residue 1 is TYROSINE — the N-terminal Tyr-Ala distinguishes this hormone from GLP-1's His-Ala and is the single quickest way to tell a GIP-derived scaffold from a GLP-1-derived one.
03
Structural characteristics
Human GIP was isolated from small-intestinal extracts and sequenced by Edman degradation, together with the N-terminally truncated forms GIP(10-42), GIP(11-42) and GIP(17-42). Its N-terminal Tyr-Ala is a DPP-IV substrate; the enzyme releases Tyr-Ala to give GIP(3-42), and the same work identified this as the main degradation route in human serum. Because an intact N-terminus is required for activity in this peptide family, the truncated form is a different substance rather than degraded material of the same one.
04
Molecular targets & mechanisms
05
Analytical considerations
Require human species, full length and an intact N terminus. A total-GIP assay is not automatically an intact-GIP assay. For any comparison against a GIP-derived analog, retain explicit residue numbering — Ala13, Met14, Ile17 and His18 are positions where off-by-one errors in modification tables are common, because the analogs substitute at several of them.
06
Verified bibliography
- The isolation and sequencing of human gastric inhibitory peptide (GIP).current
Moody AJ, Thim L, Valverde I
FEBS letters · 1984-07-09 · Journal Article
- Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum.current
Mentlein R, Gallwitz B, Schmidt WE
European journal of biochemistry · 1993-06-15 · Journal Article
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →