Compound monograph
GLP-1(7-36) amide
GLP-1(7-36) amide is an endogenous processing form of glucagon-like peptide-1 and the native ligand against which the GLP-1 receptor agonists in this library are compared.
01
Identity & nomenclature
GLP-1(7-36) amide is an endogenous processing form of glucagon-like peptide-1 and the native ligand against which the GLP-1 receptor agonists in this library are compared.
'GLP-1(7-36)' without an amidation designation is not sufficiently specified. This entry is the AMIDATED form; GLP-1(7-37) is a separate molecule with an additional terminal glycine and a free carboxyl, recorded separately in this library. Amidation is not a counterion difference. GLP-1(1-37) is the N-terminally extended proform and is not this hormone; describing it as an inactive precursor is appropriate only in the sense that it is not the conventional mature insulinotropic form.
Declared aliases and development codes: GLP-1(7-36)amide, GLP-1 7-36 amide, Insulinotropin.
02
Molecular properties
| Molecular formula | C149H226N40O45 |
|---|---|
| Molecular mass | 3297.7 Da |
| CAS Registry Number | 107444-51-9 |
| PubChem CID | 16133831 |
| UNII | 0JS9125PIZ |
| One-letter sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
Thirty residues ending in an amidated arginine. The conventional 7-36 numbering is retained rather than renumbering the mature N-terminal histidine as residue 1 — every modification table for every GLP-1 analog in this library uses that convention, and silently renumbering produces wrong records.
03
Structural characteristics
Its N-terminal His-Ala is a substrate for dipeptidyl peptidase IV, which removes the dipeptide to give the des-His-Ala product. The enzymology was characterised directly, with kinetics consistent with degradation at nanomolar concentrations, and the released His-Ala identified. Since an intact N-terminus is required for activity in this peptide family, that cleavage is an identity question and not merely sample ageing. It is also the reason essentially every GLP-1-derived analog in this library carries a substitution at position 8.
Terminal features: C-terminal amide.
04
Molecular targets & mechanisms
05
Analytical considerations
The C-terminal modification must be part of the identity record; a generic GLP-1 measurement is not form-specific without demonstrated assay discrimination. Intact peptide must also be distinguished from the DPP-IV product; total GLP-1 immunoreactivity does not establish intact-molecule identity. This entry and GLP-1(7-37) are distinct native processing forms, not aliases — though note that the source comparing them directly found them equipotent, so the distinction recorded here is chemical rather than functional.
06
Verified bibliography
- Glucagon-like peptide-1 7-36: a physiological incretin in man.current
Kreymann B, Williams G, Ghatei MA, Bloom SR
Lancet (London, England) · 1987-12-05 · Journal Article
- Biological effects and metabolic rates of glucagonlike peptide-1 7-36 amide and glucagonlike peptide-1 7-37 in healthy subjects are indistinguishable.current
Orskov C, Wettergren A, Holst JJ
Diabetes · 1993-05 · Journal Article
- Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum.current
Mentlein R, Gallwitz B, Schmidt WE
European journal of biochemistry · 1993-06-15 · Journal Article
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →