Compound monograph
GLP-1(7-37)
GLP-1(7-37) is an endogenous processing form of glucagon-like peptide-1 retaining a C-terminal glycine, and the structural reference for several acylated GLP-1 analogs.
01
Identity & nomenclature
GLP-1(7-37) is an endogenous processing form of glucagon-like peptide-1 retaining a C-terminal glycine, and the structural reference for several acylated GLP-1 analogs.
This is the reference scaffold for the acylated GLP-1 analogs in this library, because they retain the C-terminal glycine. 'Both are GLP-1 analogs' is not sufficient for this corpus: which native form an analog is built on determines whether its modification table is right. Neither CAS nor UNII is recorded here — an unsalted identity was not reconciled to an authoritative record, and an acetate-specific identifier is not an acceptable substitute.
Declared aliases and development codes: GLP-1 7-37, GLP-I(7-37).
02
Molecular properties
| Molecular formula | C151H228N40O47 |
|---|---|
| Molecular mass | 3355.7 Da |
| One-letter sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Thirty-one residues ending in glycine with a FREE C-terminal carboxyl. Distinct from both the amidated 30-residue form and from GLP-1(1-37). Conventional 7-37 numbering retained: Ala8 is the second residue of the mature peptide, Lys26 the twentieth, Lys34 the twenty-eighth. Mixing numbering systems silently produces incorrect modification records for every analog derived from this scaffold.
03
Structural characteristics
Work in the isolated perfused rat pancreas established this form as a potent stimulator of insulin secretion at concentrations as low as 5 x 10^-11 M, while the N-terminally extended GLP-1(1-37) had no effect at concentrations four orders of magnitude higher. That contrast is what makes the processing-form distinction a real identity question rather than a matter of notation. A separate human comparison of this form against the amidated form found them equipotent and concluded that C-terminal amidation is important for neither metabolism nor pancreatic effect — so this library records two distinct molecules on chemical grounds while reporting that the source examining them found no functional difference.
Terminal features: Free C-terminal carboxyl.
04
Molecular targets & mechanisms
05
Analytical considerations
Terminal glycine, terminal carboxyl state and N-terminal processing state must each be independently visible. An ambiguous GLP-1 identity cannot be resolved by matching only the internal sequence segment shared by both active forms, since that segment is identical.
06
Verified bibliography
- Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon gene is a potent stimulator of insulin release in the perfused rat pancreas.current
Mojsov S, Weir GC, Habener JF
The Journal of clinical investigation · 1987-02 · Journal Article
- Biological effects and metabolic rates of glucagonlike peptide-1 7-36 amide and glucagonlike peptide-1 7-37 in healthy subjects are indistinguishable.current
Orskov C, Wettergren A, Holst JJ
Diabetes · 1993-05 · Journal Article
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →