Compound monograph
SHLP3
SHLP3 is a 38-residue peptide from the same mitochondrial region as humanin, characterised principally through the study that named the series.
01
Identity & nomenclature
SHLP3 is a 38-residue peptide from the same mitochondrial region as humanin, characterised principally through the study that named the series.
The number denotes a distinct peptide, not an activity rank and not a shortened humanin. PubChem and GSRS searches found no exact registry identifier for the specified 38-residue free peptide with C214H301N47O49S2; this bounded result does not establish that registration is impossible or excluded by molecular size. Mature endogenous termini and intact endogenous sequence confirmation are UNKNOWN; a synthetic peptide showing activity does not demonstrate that the same mature molecule is produced physiologically.
Canonical name: Small humanin-like peptide 3.
Declared aliases and development codes: SHLP-3.
02
Molecular properties
| Molecular formula | C214H301N47O49S2 |
|---|---|
| Molecular mass | 4380.2 Da |
| One-letter sequence | MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW |
| Terminal groups | Free N-terminus; Free C-terminal carboxyl |
Thirty-eight residues with free termini and a cysteine at position 11. The recorded sequence has valine at position 29; substitution with tryptophan would change both formula and mass.
03
Structural characteristics
The discovery study identified small open reading frames in the mitochondrial 16S rRNA region and found different cellular responses among the SHLP peptides. SHLP3 induced ERK phosphorylation without detectable STAT3 phosphorylation in the reported comparison. No direct receptor assignment is established here. The conservation analysis found no significant synonymous codon bias and poor conservation for SHLP3, arguing against amino-acid sequence constraint despite the reported cellular observations.
Terminal features: Free N-terminus, Free C-terminal carboxyl.
04
Molecular targets & mechanisms
05
Analytical considerations
Sequence confirmation should distinguish valine from tryptophan at position 29 and establish both termini. One cysteine permits intermolecular disulfide formation, and methionine oxidation changes mass. A matching retention time or nominal mass does not establish residue order or leucine/isoleucine assignments.
Disagreements and mix-ups
Points where sources disagree about this compound's identity, or where a name or form is easily confused with another, as noted in this record. The discrepancy register quotes the passage for each one.
Often mixed up · Name or substance
SHLPs are not humanin fragments
What the studies reported
Each finding describes one cited study in its stated model. These observations are specific to that study and do not establish effects in other settings.
Cell and tissue studies
Insulin-exposed murine 3T3-L1 pre-adipocytes and Oil Red-O staining assay
Using insulin-exposed murine 3T3-L1 pre-adipocytes and Oil Red-O staining, the study observed accelerated differentiation with SHLP3.
Reference [1]Murine NIT-1 β-cells and human prostate cancer 22Rv1 cells under serum starvation
In murine NIT-1 β-cells and human prostate cancer 22Rv1 cells under serum starvation, the study observed increased viability and decreased apoptosis with SHLP3.
Reference [1]
Animal studies
Conscious Sprague Dawley rats studied with insulin clamps
In conscious Sprague Dawley rats studied with insulin clamps (n = 6), the study observed no effect of SHLP3 on insulin action in vivo.
Reference [1]C57BL/6 mouse serum biomarker assays
In C57BL/6 mice (n = 5), the study reported significantly increased serum IL-6 and MCP-1 levels with SHLP3.
Reference [1]C57BL/6 mouse serum insulin assay
In C57BL/6 mice (n = 5), the study observed no effect of SHLP3 on serum insulin levels.
Reference [1]
Computational studies
Comparative vertebrate mitochondrial coding-sequence analysis
Using comparative vertebrate mitochondrial coding-sequence analysis, the study reported no significant synonymous codon bias and poor conservation for SHLP3.
Reference [2]
06
Verified bibliography
Cited studies by type
The 3 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Naturally occurring mitochondrial-derived peptides are age-dependent regulators of apoptosis, insulin sensitivity, and inflammatory markers.Cobb LJ, Lee C, Xiao J, Yen K, Wong RG, Nakamura HK, Mehta HH, Gao Q, Ashur C, Huffman DM, Wan J, Muzumdar R, Barzilai N, Cohen P
Aging · 2016-04 · Journal Article
currentReference 2
Evidence of natural selection in the mitochondrial-derived peptides humanin and SHLP6.Gruschus JM, Morris DL, Tjandra N
Scientific reports · 2023-08-29 · Journal Article
currentReference 3
The mitochondrial-derived peptide MOTS-c promotes metabolic homeostasis and reduces obesity and insulin resistance.Lee C, Zeng J, Drew BG, Sallam T, Martin-Montalvo A, Wan J, Kim SJ, Mehta H, Hevener AL, de Cabo R, Cohen P
Cell metabolism · 2015-03-03 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Cobb LJ et al. 2016 | Study models reported: in vitro; animal (rat, mouse) · from the full text |
| Gruschus JM et al. 2023 | Computational analysis |
| Lee C et al. 2015 | Study models reported: in vitro; animal (mouse) · from the full text |
Record history
Published 2026-09-16.
- : Identity and nomenclature
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. SHLP3. Published 2026-09-16; updated 2026-10-13. https://purelypeptides.org/research/compounds/shlp3/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →