Compound monograph
Human brain natriuretic peptide (1–32)
Human brain natriuretic peptide (1–32) is a 32-residue peptide with free termini and one intramolecular disulfide between Cys10 and Cys26.
01
Identity & nomenclature
Human brain natriuretic peptide (1–32) is a 32-residue peptide with free termini and one intramolecular disulfide between Cys10 and Cys26.
Nesiritide is the WHO-issued name for the qualified human parent. The routing abbreviation does not combine precursor or formulation identities. PubChem CID is withheld because two issuer records match without a resolved single assignment.
Canonical name: Nesiritide.
02
Molecular properties
| Molecular formula | C143H244N50O42S4 |
|---|---|
| Molecular mass | 3464.073 Da |
| CAS Registry Number | 124584-08-3 |
| UNII | P7WI8UL647 |
| One-letter sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Three-letter sequence | Ser–Pro–Lys–Met–Val–Gln–Gly–Ser–Gly–Cys–Phe–Gly–Arg–Lys–Met–Asp–Arg–Ile–Ser–Ser–Ser–Ser–Gly–Leu–Gly–Cys–Lys–Val–Leu–Arg–Arg–His |
| Terminal groups | Free N-terminus; Free C-terminal carboxyl |
Positions count the mature human chain from Ser1 to His32. All chiral residues are L and glycine is achiral. The backbone has 31 peptide bonds and the Cys10-Cys26 disulfide is an additional side-chain closure.
03
Structural characteristics
Positions count the mature human chain from Ser1 to His32. All chiral residues are L and glycine is achiral. The backbone has 31 peptide bonds and the Cys10-Cys26 disulfide is an additional side-chain closure.
- Cys10-Cys26 intramolecular disulfide
Ring closures: covalent bonds between residues, by position counted from the first residue of the chain.
- Disulfide Cys10–Cys26: thiol sulfur (Sγ) to thiol sulfur (Sγ). Registry source: WHO Recommended INN List 42, nesiritide, printed page 198; FDA GSRS UNII P7WI8UL647 disulfide definition.
Terminal features: Free N-terminus, Free C-terminal carboxyl.
04
Molecular targets & mechanisms
05
Analytical considerations
The molecular formula describes the parent; the average mass is calculated using CIAAW 2024 abridged atomic weights. GSRS records the non-defining estimated formula C143H246N50O42S4, differing from the derived composition by H2. Its non-defining average is 3464.0 Da: +0.073 Da (+21.0739 ppm). FDA prints 3464 Da under an unestablished mass convention. These source figures do not replace the derived formula or mass.
What the studies reported
No verified findings are published for this record under Content Policy v1.
06
Verified bibliography
Cited studies by type
The 2 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Isolation and sequence determination of human brain natriuretic peptide in human atrium.Kambayashi Y, Nakao K, Mukoyama M, Saito Y, Ogawa Y, Shiono S, Inouye K, Yoshida N, Imura H
FEBS letters · 1990-01-01 · Journal Article
currentReference 2
Isolation and identification of human brain natriuretic peptides in cardiac atrium.Hino J, Tateyama H, Minamino N, Kangawa K, Matsuo H
Biochemical and biophysical research communications · 1990-03-16 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Kambayashi Y et al. 1990 | Chemical, structural or analytical study; no biological model reported |
| Hino J et al. 1990 | Chemical, structural or analytical study; no biological model reported |
Record history
Published 2026-10-21.
No changes to this record's content have been recorded since publication.
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. Human brain natriuretic peptide (1–32). Published 2026-10-21. https://purelypeptides.org/research/compounds/bnp/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →