Compound monograph
Enfuvirtide
Enfuvirtide is a synthetic linear peptide comprising 36 L-amino-acid residues, with an acetylated N terminus and a C-terminal amide.
01
Identity & nomenclature
Enfuvirtide is a synthetic linear peptide comprising 36 L-amino-acid residues, with an acetylated N terminus and a C-terminal amide.
The historical codes T20, T-20 and DP-178 are admitted for the defined parent. Acetyl and amide caps are terminal modifications rather than chain tokens. No salt or hydrate equivalence is inferred.
Declared aliases and development codes: T20, T-20, DP-178.
02
Molecular properties
| Molecular formula | C204H301N51O64 |
|---|---|
| Molecular mass | 4491.945 Da |
| CAS Registry Number | 159519-65-0 |
| PubChem CID | 16130199 |
| UNII | 19OWO1T3ZE |
| One-letter sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Three-letter sequence | Tyr–Thr–Ser–Leu–Ile–His–Ser–Leu–Ile–Glu–Glu–Ser–Gln–Asn–Gln–Gln–Glu–Lys–Asn–Glu–Gln–Glu–Leu–Leu–Glu–Leu–Asp–Lys–Trp–Ala–Ser–Leu–Trp–Asn–Trp–Phe |
| Terminal groups | N-terminal acetylation; C-terminal amide |
Positions count the mature chain from 1. All chiral amino-acid residues are L; glycine is achiral. Terminal groups are recorded separately.
03
Structural characteristics
The chain contains standard L-amino-acid residues and no inter-residue covalent closure.
Terminal features: N-terminal acetylation, C-terminal amide.
04
Molecular targets & mechanisms
05
Analytical considerations
The molecular formula describes the parent; the average mass is calculated using CIAAW 2024 abridged atomic weights. PubChem formula C204H301N51O64 matches the covalent derivation. GSRS carries non-defining estimated C204H302N51O66 and 4450.0 Da: +41.945 Da (+9425.842697 ppm). DailyMed displays 4492, a non-defining difference of -0.055 Da (-12.243989 ppm) if compared as an average; its exact convention is unestablished. Neutral monoisotopic mass and MS ion values are separate quantities.
What the studies reported
No verified findings are published for this record under Content Policy v1.
06
Verified bibliography
Cited studies by type
The 3 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Broad antiviral activity and crystal structure of HIV-1 fusion inhibitor sifuvirtide.Yao X, Chong H, Zhang C, Waltersperger S, Wang M, Cui S, He Y
The Journal of biological chemistry · 2012-01-06 · Journal Article
currentReference 2
Interactions of HIV-1 inhibitory peptide T20 with the gp41 N-HR coiled coil.Champagne K, Shishido A, Root MJ
The Journal of biological chemistry · 2008-12-10 · Journal Article
currentReference 3
Structural and functional characterization of HIV-1 cell fusion inhibitor T20.Zhang X, Ding X, Zhu Y, Chong H, Cui S, He J, Wang X, He Y
AIDS (London, England) · 2019-01-27 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Yao X et al. 2012 | Study models reported: in vitro · from the abstract |
| Champagne K et al. 2008 | Study models reported: in vitro · from the abstract |
| Zhang X et al. 2019 | Study models reported: in vitro · from the abstract |
Record history
Published 2026-10-21.
No changes to this record's content have been recorded since publication.
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. Enfuvirtide. Published 2026-10-21. https://purelypeptides.org/research/compounds/enfuvirtide/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →