Compound monograph
PACAP-38
PACAP-38 is a linear 38-residue peptide with a free N-terminal histidine and a C-terminal lysinamide.
01
Identity & nomenclature
PACAP-38 is a linear 38-residue peptide with a free N-terminal histidine and a C-terminal lysinamide.
Length and terminal state qualify the parent identity. PACAP(1-38) is withheld as an unestablished alias. PubChem CID is withheld because three matching issuer records remain unresolved. No blanket species or salt equivalence is assigned.
Canonical name: PACAP38.
Declared aliases and development codes: PACAP 38.
02
Molecular properties
| Molecular formula | C203H331N63O53S |
|---|---|
| Molecular mass | 4534.329 Da |
| CAS Registry Number | 124123-15-5 |
| UNII | LK78T72MLT |
| One-letter sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Three-letter sequence | His–Ser–Asp–Gly–Ile–Phe–Thr–Asp–Ser–Tyr–Ser–Arg–Tyr–Arg–Lys–Gln–Met–Ala–Val–Lys–Lys–Tyr–Leu–Ala–Ala–Val–Leu–Gly–Lys–Arg–Tyr–Lys–Gln–Arg–Val–Lys–Asn–Lys |
| Terminal groups | Free N-terminus; C-terminal amide |
Positions count the mature chain from 1. All chiral amino-acid residues are L; glycine is achiral. Terminal groups are recorded separately.
03
Structural characteristics
The chain contains standard L-amino-acid residues and no inter-residue covalent closure.
Terminal features: Free N-terminus, C-terminal amide.
04
Molecular targets & mechanisms
05
Analytical considerations
The molecular formula describes the parent; the average mass is calculated using CIAAW 2024 abridged atomic weights. GSRS carries the non-defining estimated formula C203H329N63O52S, differing by H2O, and estimated average 4530 Da: +4.329 Da (+955.629 ppm). PubChem displays 4534 Da: +0.329 Da (+72.563 ppm), consistent with whole-unit display rounding. An analytical table prints calculated 4534.3 (+0.029 Da, +6.396 ppm) under an unestablished mass convention; a patent reports SIMS (M+H) 4530 under an incompletely specified ion convention. None defines the neutral average.
What the studies reported
No verified findings are published for this record under Content Policy v1.
06
Verified bibliography
Cited studies by type
The 2 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells.Miyata A, Arimura A, Dahl RR, Minamino N, Uehara A, Jiang L, Culler MD, Coy DH
Biochemical and biophysical research communications · 1989-10-16 · Journal Article
currentReference 2
Stability Test of PACAP in Eye Drops.Kovacs AK, Atlasz T, Werling D, Szabo E, Reglodi D, Toth GK
Journal of molecular neuroscience : MN · 2020-04-22 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Miyata A et al. 1989 | Study models reported: in vitro · from the abstract |
| Kovacs AK et al. 2020 | Chemical, structural or analytical study; no biological model reported |
Record history
Published 2026-10-21.
No changes to this record's content have been recorded since publication.
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. PACAP-38. Published 2026-10-21. https://purelypeptides.org/research/compounds/pacap-38/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →