Compound monograph
Salmon calcitonin
Salmon calcitonin is a 32-residue peptide with a free N terminus, C-terminal prolinamide and a Cys1-Cys7 disulfide. This record describes the parent without counterion or hydration components.
01
Identity & nomenclature
Salmon calcitonin is a 32-residue peptide with a free N terminus, C-terminal prolinamide and a Cys1-Cys7 disulfide. This record describes the parent without counterion or hydration components.
Calcitonin salmon is an admitted word-order alias. This record identifies the full-length parent peptide; production method alone does not establish a distinct molecular species or universal equivalence between preparations. No unique PubChem CID is admitted because competing issuer records remain unresolved.
Declared aliases and development codes: Calcitonin salmon.
02
Molecular properties
| Molecular formula | C145H240N44O48S2 |
|---|---|
| Molecular mass | 3431.895 Da |
| CAS Registry Number | 47931-85-1 |
| UNII | 7SFC6U2VI5 |
| One-letter sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Three-letter sequence | Cys–Ser–Asn–Leu–Ser–Thr–Cys–Val–Leu–Gly–Lys–Leu–Ser–Gln–Glu–Leu–His–Lys–Leu–Gln–Thr–Tyr–Pro–Arg–Thr–Asn–Thr–Gly–Ser–Gly–Thr–Pro |
| Terminal groups | Free N-terminus; C-terminal amidation |
Positions count the 32-residue mature chain. All chiral residues are L; glycine is achiral. Val8, Lys11 and Pro32 are retained explicitly. Terminal amidation and the Cys1-Cys7 disulfide are recorded separately.
03
Structural characteristics
The 32-residue backbone has a free N terminus at Cys1 and a C-terminal amide at Pro32. Meyer et al. and the Japanese Pharmacopoeia XVIII connectivity diagram support the Cys1-Cys7 disulfide. Niall et al. provide sequence and terminal characterization; their tentative disulfide discussion is not used as the sole connectivity proof. Counterions, hydration components, synthetic intermediates and sulfur-modified derivatives are excluded from this parent.
- Cys1-Cys7 intramolecular disulfide
Ring closures: covalent bonds between residues, by position counted from the first residue of the chain.
- Disulfide Cys1–Cys7: thiol sulfur (Sγ) to thiol sulfur (Sγ). Source: PMID 2043752.
Terminal features: Free N-terminus, C-terminal amidation.
04
Molecular targets & mechanisms
05
Analytical considerations
The formula and 3431.895 Da average mass are calculated using CIAAW 2024 abridged atomic weights. Japanese Pharmacopoeia XVIII reports 3431.85, a non-defining difference of 0.045 Da (13.1125 ppm). PubChem reports 3431.9 under an average-mass convention; DailyMed prints 3432 without an established convention in the inspected description. Neither replaces the defined calculation. Niall et al. sequence determination and Meyer et al. synthetic-peptide NMR provide complementary identity evidence; a preparation-independent solution conformation is not assigned.
What the studies reported
No verified findings are published for this record under Content Policy v1.
06
Verified bibliography
Cited studies by type
The 2 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Amino acid sequence of salmon ultimobranchial calcitonin.Niall HD, Keutmann HT, Copp DH, Potts JT Jr
Proceedings of the National Academy of Sciences of the United States of America · 1969-10 · Journal Article
currentReference 2
Solution structure of salmon calcitonin.Meyer JP, Pelton JT, Hoflack J, Saudek V
Biopolymers · 1991-02-05 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Niall HD et al. 1969 | Chemical, structural or analytical study; no biological model reported |
| Meyer JP et al. 1991 | Chemical, structural or analytical study; no biological model reported |
Record history
Published 2026-10-20.
No changes to this record's content have been recorded since publication.
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. Salmon calcitonin. Published 2026-10-20. https://purelypeptides.org/research/compounds/salmon-calcitonin/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →