Compound monograph
Human corticotropin-releasing factor (1–41) amide
Corticorelin (human/rat sequence) is a 41-residue peptide with a free N terminus and an amidated C-terminal isoleucine.
01
Identity & nomenclature
Corticorelin (human/rat sequence) is a 41-residue peptide with a free N terminus and an amidated C-terminal isoleucine.
The issued name Corticorelin is qualified here for the human/rat sequence. CRF requires organism and form qualification. Salt formulations and differently qualified organism sequences are excluded. PubChem CID is withheld because the dossier did not complete the full graph match.
Canonical name: Corticorelin (human/rat sequence).
Declared aliases and development codes: hCRF, Human corticotropin-releasing factor, Rat corticotropin-releasing factor.
02
Molecular properties
| Molecular formula | C208H344N60O63S2 |
|---|---|
| Molecular mass | 4757.517 Da |
| CAS Registry Number | 86784-80-7 |
| UNII | 305OE8862Y |
| One-letter sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Three-letter sequence | Ser–Glu–Glu–Pro–Pro–Ile–Ser–Leu–Asp–Leu–Thr–Phe–His–Leu–Leu–Arg–Glu–Val–Leu–Glu–Met–Ala–Arg–Ala–Glu–Gln–Leu–Ala–Gln–Gln–Ala–His–Ser–Asn–Arg–Lys–Leu–Met–Glu–Ile–Ile |
| Terminal groups | Free N-terminus; C-terminal amide |
Positions count the mature chain from 1. All chiral amino-acid residues are L; glycine is achiral. Terminal groups are recorded separately.
03
Structural characteristics
The chain contains standard L-amino-acid residues and no inter-residue covalent closure.
Terminal features: Free N-terminus, C-terminal amide.
04
Molecular targets & mechanisms
05
Analytical considerations
The molecular formula describes the parent; the average mass is calculated using CIAAW 2024 abridged atomic weights. GSRS estimates 4757.0 Da, a non-defining difference of +0.517 Da (+108.682 ppm). The calculation does not certify a physical preparation. The synthetic human-sequence preparation and native rat sequencing are distinct evidence; partial native human sequencing is not represented as a complete independent determination.
What the studies reported
No verified findings are published for this record under Content Policy v1.
06
Verified bibliography
Cited studies by type
The 4 papers this record cites, counted by the kind of work each reports. A count is the size of this record's selection, not of the research that exists, and says nothing about results, safety, effectiveness or approval.
A paper can report more than one kind of work. Each count opens those papers in the bibliography. Compare every record on the Evidence Map.
Reference 1
Sequence analysis of rat hypothalamic corticotropin-releasing factor with the o-phthalaldehyde strategy.Spiess J, Rivier J, Vale W
Biochemistry · 1983-08-30 · Journal Article
currentReference 2
Studies on peptides. CXXIV. Solution synthesis of the hentetracontapeptide amide corresponding to the entire amino acid sequence of human corticotropin releasing factor (hCRF).Fujii N, Nomizu M, Akaji K, Watanabe K, Shimokura M, Katakura S, Yajima H, Shono F, Tsuda M, Yoshitake A
Chemical & pharmaceutical bulletin · 1984-12 · Journal Article
currentReference 3
Expression cloning of a human corticotropin-releasing-factor receptor.Chen R, Lewis KA, Perrin MH, Vale WW
Proceedings of the National Academy of Sciences of the United States of America · 1993-10-01 · Journal Article
currentReference 4
Toward a Structural Understanding of Class B GPCR Peptide Binding and Activation.Liang YL, Belousoff MJ, Zhao P, Koole C, Fletcher MM, Truong TT, Julita V, Christopoulos G, Xu HE, Zhang Y, Khoshouei M, Christopoulos A, Danev R, Sexton PM, Wootten D
Molecular cell · 2020-01-30 · Journal Article
current
Study models of these references
What kind of experiment each cited paper reports, taken from its abstract unless marked. Not a summary of results.
| Reference | Study models |
|---|---|
| Spiess J et al. 1983 | Chemical, structural or analytical study; no biological model reported |
| Fujii N et al. 1984 | Chemical, structural or analytical study; no biological model reported |
| Chen R et al. 1993 | Study models reported: in vitro · from the abstract |
| Liang YL et al. 2020 | Study models reported: in vitro · from the abstract |
Record history
Published 2026-10-21.
No changes to this record's content have been recorded since publication.
Each entry names the parts of this record that changed on that date. Changes to links between records and to catalogue links are not listed. This history covers the tracked record fields; study findings are not listed here.
Cite this record: Purely Peptides Research Library. Human corticotropin-releasing factor (1–41) amide. Published 2026-10-21. https://purelypeptides.org/research/compounds/crf/
10
Methodology & citation verification
Reference identity is checked against official PubMed metadata. Local deterministic receipts bind each normalized title and canonical metadata record to its verification date. Scientific values remain absent when an authoritative source has not been verified.
Read the full methodology →